Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4763553..4764069 | Replicon | chromosome |
Accession | NZ_CP110661 | ||
Organism | Klebsiella pneumoniae strain B431 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | OOS97_RS23215 | Protein ID | WP_002886902.1 |
Coordinates | 4763785..4764069 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OOS97_RS23210 | Protein ID | WP_002886901.1 |
Coordinates | 4763553..4763795 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOS97_RS23195 (4759581) | 4759581..4760321 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
OOS97_RS23200 (4760388) | 4760388..4761542 | + | 1155 | WP_023302389.1 | lactonase family protein | - |
OOS97_RS23205 (4761565) | 4761565..4763475 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
OOS97_RS23210 (4763553) | 4763553..4763795 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OOS97_RS23215 (4763785) | 4763785..4764069 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OOS97_RS23220 (4764073) | 4764073..4764537 | - | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OOS97_RS23225 (4764846) | 4764846..4766984 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OOS97_RS23230 (4767341) | 4767341..4768084 | - | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
OOS97_RS23235 (4768087) | 4768087..4768260 | - | 174 | WP_032410138.1 | hypothetical protein | - |
OOS97_RS23240 (4768390) | 4768390..4768653 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T264112 WP_002886902.1 NZ_CP110661:4763785-4764069 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |