Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4285467..4286092 | Replicon | chromosome |
| Accession | NZ_CP110661 | ||
| Organism | Klebsiella pneumoniae strain B431 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | OOS97_RS20960 | Protein ID | WP_002882817.1 |
| Coordinates | 4285709..4286092 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | OOS97_RS20955 | Protein ID | WP_004150355.1 |
| Coordinates | 4285467..4285709 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOS97_RS20930 (4281458) | 4281458..4282057 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| OOS97_RS20935 (4282051) | 4282051..4282911 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| OOS97_RS20940 (4282908) | 4282908..4283345 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| OOS97_RS20945 (4283390) | 4283390..4284331 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| OOS97_RS20950 (4284345) | 4284345..4285262 | - | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
| OOS97_RS20955 (4285467) | 4285467..4285709 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| OOS97_RS20960 (4285709) | 4285709..4286092 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OOS97_RS20965 (4286266) | 4286266..4287195 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| OOS97_RS20970 (4287192) | 4287192..4287827 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OOS97_RS20975 (4287824) | 4287824..4288726 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T264110 WP_002882817.1 NZ_CP110661:4285709-4286092 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |