Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3421286..3421943 | Replicon | chromosome |
Accession | NZ_CP110661 | ||
Organism | Klebsiella pneumoniae strain B431 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OOS97_RS16685 | Protein ID | WP_002916310.1 |
Coordinates | 3421286..3421696 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OOS97_RS16690 | Protein ID | WP_002916312.1 |
Coordinates | 3421677..3421943 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOS97_RS16665 (3417286) | 3417286..3419019 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OOS97_RS16670 (3419025) | 3419025..3419738 | - | 714 | WP_004185548.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OOS97_RS16675 (3419761) | 3419761..3420657 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OOS97_RS16680 (3420758) | 3420758..3421279 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
OOS97_RS16685 (3421286) | 3421286..3421696 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
OOS97_RS16690 (3421677) | 3421677..3421943 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OOS97_RS16695 (3422189) | 3422189..3423172 | + | 984 | WP_023342614.1 | tRNA-modifying protein YgfZ | - |
OOS97_RS16700 (3423323) | 3423323..3423982 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
OOS97_RS16705 (3424146) | 3424146..3424457 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
OOS97_RS16710 (3424507) | 3424507..3425235 | + | 729 | WP_023342613.1 | MurR/RpiR family transcriptional regulator | - |
OOS97_RS16715 (3425354) | 3425354..3426787 | + | 1434 | WP_265397530.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T264107 WP_002916310.1 NZ_CP110661:c3421696-3421286 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |