Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 4596723..4597245 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | OOK64_RS22605 | Protein ID | WP_000221343.1 |
Coordinates | 4596723..4597007 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OOK64_RS22610 | Protein ID | WP_000885424.1 |
Coordinates | 4596997..4597245 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS22585 (4592798) | 4592798..4594306 | - | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
OOK64_RS22590 (4594351) | 4594351..4594839 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OOK64_RS22595 (4595032) | 4595032..4596111 | + | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OOK64_RS22600 (4596163) | 4596163..4596552 | - | 390 | WP_000194089.1 | RidA family protein | - |
OOK64_RS22605 (4596723) | 4596723..4597007 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OOK64_RS22610 (4596997) | 4596997..4597245 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OOK64_RS22615 (4597397) | 4597397..4597612 | + | 216 | WP_000206207.1 | hypothetical protein | - |
OOK64_RS22620 (4597602) | 4597602..4597934 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
OOK64_RS22625 (4598077) | 4598077..4598985 | + | 909 | WP_010989018.1 | hypothetical protein | - |
OOK64_RS22630 (4599041) | 4599041..4599755 | - | 715 | Protein_4407 | helix-turn-helix domain-containing protein | - |
OOK64_RS22635 (4600563) | 4600563..4602029 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T264099 WP_000221343.1 NZ_CP110657:c4597007-4596723 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |