Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3548545..3549165 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OOK64_RS17335 | Protein ID | WP_001280991.1 |
Coordinates | 3548545..3548763 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OOK64_RS17340 | Protein ID | WP_000344807.1 |
Coordinates | 3548791..3549165 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS17295 (3543769) | 3543769..3544338 | + | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
OOK64_RS17300 (3544371) | 3544371..3544760 | - | 390 | WP_000961285.1 | MGMT family protein | - |
OOK64_RS17310 (3544991) | 3544991..3546541 | - | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
OOK64_RS17315 (3546766) | 3546766..3547026 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OOK64_RS17320 (3547032) | 3547032..3547172 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OOK64_RS17325 (3547228) | 3547228..3547698 | - | 471 | WP_000136181.1 | YlaC family protein | - |
OOK64_RS17330 (3547815) | 3547815..3548366 | - | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
OOK64_RS17335 (3548545) | 3548545..3548763 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OOK64_RS17340 (3548791) | 3548791..3549165 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OOK64_RS17345 (3549661) | 3549661..3552810 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OOK64_RS17350 (3552833) | 3552833..3554026 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T264098 WP_001280991.1 NZ_CP110657:c3548763-3548545 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT264098 WP_000344807.1 NZ_CP110657:c3549165-3548791 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|