Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 2904743..2905319 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | OOK64_RS14225 | Protein ID | WP_001131963.1 |
Coordinates | 2904743..2905030 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | OOK64_RS14230 | Protein ID | WP_000063142.1 |
Coordinates | 2905017..2905319 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS14215 (2899853) | 2899853..2903362 | - | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
OOK64_RS14220 (2903560) | 2903560..2904474 | + | 915 | WP_000290512.1 | restriction endonuclease | - |
OOK64_RS14225 (2904743) | 2904743..2905030 | + | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
OOK64_RS14230 (2905017) | 2905017..2905319 | + | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
OOK64_RS14235 (2905394) | 2905394..2906350 | - | 957 | WP_000187839.1 | GTPase | - |
OOK64_RS14240 (2906361) | 2906361..2906564 | - | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
OOK64_RS14245 (2906659) | 2906659..2908809 | - | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T264095 WP_001131963.1 NZ_CP110657:2904743-2905030 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|