Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2600199..2600980 | Replicon | chromosome |
| Accession | NZ_CP110657 | ||
| Organism | Salmonella enterica subsp. enterica strain S2122 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | E8X9W8 |
| Locus tag | OOK64_RS12725 | Protein ID | WP_000626099.1 |
| Coordinates | 2600489..2600980 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | OOK64_RS12720 | Protein ID | WP_001110452.1 |
| Coordinates | 2600199..2600492 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK64_RS12690 (2596523) | 2596523..2597428 | + | 906 | WP_001268200.1 | YjiK family protein | - |
| OOK64_RS12695 (2597722) | 2597722..2597991 | - | 270 | WP_010989096.1 | hypothetical protein | - |
| OOK64_RS12700 (2597999) | 2597999..2598214 | - | 216 | WP_001595136.1 | hypothetical protein | - |
| OOK64_RS12705 (2598237) | 2598237..2598524 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| OOK64_RS12710 (2598521) | 2598521..2599396 | - | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| OOK64_RS12715 (2599661) | 2599661..2599882 | - | 222 | WP_001576552.1 | hypothetical protein | - |
| OOK64_RS12720 (2600199) | 2600199..2600492 | + | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| OOK64_RS12725 (2600489) | 2600489..2600980 | + | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
| OOK64_RS12730 (2601228) | 2601228..2601980 | - | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
| OOK64_RS12735 (2602083) | 2602083..2602157 | - | 75 | Protein_2474 | porin family protein | - |
| OOK64_RS12740 (2603190) | 2603190..2603567 | - | 378 | WP_000916345.1 | EthD family reductase | - |
| OOK64_RS12745 (2603639) | 2603639..2603971 | + | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
| OOK64_RS12750 (2604062) | 2604062..2604139 | + | 78 | Protein_2477 | helix-turn-helix domain-containing protein | - |
| OOK64_RS12755 (2604330) | 2604330..2605202 | + | 873 | WP_033567082.1 | ParA family protein | - |
| OOK64_RS12760 (2605199) | 2605199..2605555 | + | 357 | WP_033567083.1 | hypothetical protein | - |
| OOK64_RS12765 (2605552) | 2605552..2605794 | + | 243 | WP_197603740.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T264093 WP_000626099.1 NZ_CP110657:2600489-2600980 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |