Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1876280..1877040 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | OOK64_RS09370 | Protein ID | WP_000533909.1 |
Coordinates | 1876280..1876765 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | OOK64_RS09375 | Protein ID | WP_000965886.1 |
Coordinates | 1876753..1877040 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS09340 (1871350) | 1871350..1872012 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
OOK64_RS09345 (1872231) | 1872231..1873205 | + | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
OOK64_RS09350 (1873255) | 1873255..1873965 | - | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
OOK64_RS09355 (1874404) | 1874404..1874694 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
OOK64_RS09360 (1874983) | 1874983..1875195 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
OOK64_RS09365 (1875369) | 1875369..1875908 | + | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
OOK64_RS09370 (1876280) | 1876280..1876765 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
OOK64_RS09375 (1876753) | 1876753..1877040 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
OOK64_RS09380 (1877218) | 1877218..1877685 | - | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
OOK64_RS09385 (1877857) | 1877857..1878132 | - | 276 | Protein_1833 | IS3 family transposase | - |
OOK64_RS09390 (1878314) | 1878314..1880383 | - | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
OOK64_RS09395 (1880393) | 1880393..1881304 | - | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
OOK64_RS09400 (1881443) | 1881443..1881745 | - | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T264090 WP_000533909.1 NZ_CP110657:c1876765-1876280 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |