Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1244580..1245240 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | OOK64_RS06305 | Protein ID | WP_000244756.1 |
Coordinates | 1244580..1244993 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | OOK64_RS06310 | Protein ID | WP_000351186.1 |
Coordinates | 1244974..1245240 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS06285 (1240521) | 1240521..1242254 | - | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OOK64_RS06290 (1242260) | 1242260..1242973 | - | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OOK64_RS06295 (1242997) | 1242997..1243893 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
OOK64_RS06300 (1244006) | 1244006..1244527 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
OOK64_RS06305 (1244580) | 1244580..1244993 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
OOK64_RS06310 (1244974) | 1244974..1245240 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
OOK64_RS06315 (1245490) | 1245490..1246470 | + | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
OOK64_RS06320 (1246586) | 1246586..1247245 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
OOK64_RS06325 (1247409) | 1247409..1247720 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
OOK64_RS06330 (1247879) | 1247879..1249312 | + | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T264087 WP_000244756.1 NZ_CP110657:c1244993-1244580 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |