Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 496309..496949 Replicon chromosome
Accession NZ_CP110654
Organism Aeromonas salmonicida strain AS1

Toxin (Protein)


Gene name vagD Uniprot ID A0A807Z4U5
Locus tag ONZ57_RS02440 Protein ID WP_005320982.1
Coordinates 496309..496722 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A807Z5T0
Locus tag ONZ57_RS02445 Protein ID WP_005320985.1
Coordinates 496719..496949 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONZ57_RS02415 (ONZ57_02415) 492683..493303 + 621 WP_232484104.1 subclass B2 metallo-beta-lactamase -
ONZ57_RS02420 (ONZ57_02420) 493451..494368 + 918 WP_088814123.1 IS5-like element ISAs4 family transposase -
ONZ57_RS02425 (ONZ57_02425) 494603..495520 + 918 WP_076611341.1 IS5-like element ISAs4 family transposase -
ONZ57_RS02430 (ONZ57_02430) 495524..495850 - 327 WP_271759635.1 hypothetical protein -
ONZ57_RS02435 (ONZ57_02435) 495869..496183 - 315 WP_225854525.1 hypothetical protein -
ONZ57_RS02440 (ONZ57_02440) 496309..496722 - 414 WP_005320982.1 PIN domain-containing protein Toxin
ONZ57_RS02445 (ONZ57_02445) 496719..496949 - 231 WP_005320985.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ONZ57_RS02450 (ONZ57_02450) 497018..497323 - 306 WP_225854310.1 integrase -
ONZ57_RS02455 (ONZ57_02455) 497317..497706 - 390 WP_139403308.1 site-specific integrase -
ONZ57_RS02460 (ONZ57_02460) 498123..499040 - 918 WP_271759636.1 IS5-like element ISAs4 family transposase -
ONZ57_RS02465 (ONZ57_02465) 499108..499513 + 406 Protein_463 IS4 family transposase -
ONZ57_RS02470 (ONZ57_02470) 499586..500977 - 1392 WP_034283822.1 T3SS effector protein-tyrosine-phosphatase AopH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - aopH 491215..508926 17711


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-42)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14935.23 Da        Isoelectric Point: 5.7146

>T264077 WP_005320982.1 NZ_CP110654:c496722-496309 [Aeromonas salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8699.88 Da        Isoelectric Point: 4.7419

>AT264077 WP_005320985.1 NZ_CP110654:c496949-496719 [Aeromonas salmonicida]
MRTVSIFKNGKNQAVRLPKDMEFQGVNDLEIIKNGDTITLRPARPDWFSLAECQKVDADFLQERTDVISDEGRFAL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A807Z4U5

Antitoxin

Source ID Structure
AlphaFold DB A0A807Z5T0

References