Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 4153967..4154607 | Replicon | chromosome |
| Accession | NZ_CP110652 | ||
| Organism | Aeromonas salmonicida strain AS2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A807Z4U5 |
| Locus tag | ONZ63_RS19575 | Protein ID | WP_005320982.1 |
| Coordinates | 4154194..4154607 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A807Z5T0 |
| Locus tag | ONZ63_RS19570 | Protein ID | WP_005320985.1 |
| Coordinates | 4153967..4154197 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONZ63_RS19545 (ONZ63_19550) | 4149943..4151334 | + | 1392 | WP_034283822.1 | T3SS effector protein-tyrosine-phosphatase AopH | - |
| ONZ63_RS19550 (ONZ63_19555) | 4151407..4151808 | - | 402 | Protein_3771 | IS4 family transposase | - |
| ONZ63_RS19555 (ONZ63_19560) | 4151876..4152793 | + | 918 | WP_076611341.1 | IS5-like element ISAs4 family transposase | - |
| ONZ63_RS19560 (ONZ63_19565) | 4153210..4153599 | + | 390 | WP_139403308.1 | site-specific integrase | - |
| ONZ63_RS19565 (ONZ63_19570) | 4153593..4153898 | + | 306 | WP_225854310.1 | integrase | - |
| ONZ63_RS19570 (ONZ63_19575) | 4153967..4154197 | + | 231 | WP_005320985.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| ONZ63_RS19575 (ONZ63_19580) | 4154194..4154607 | + | 414 | WP_005320982.1 | PIN domain-containing protein | Toxin |
| ONZ63_RS19580 (ONZ63_19585) | 4154733..4155047 | + | 315 | WP_225854525.1 | hypothetical protein | - |
| ONZ63_RS19585 (ONZ63_19590) | 4155066..4155392 | + | 327 | WP_271759635.1 | hypothetical protein | - |
| ONZ63_RS19590 (ONZ63_19595) | 4155396..4156313 | - | 918 | WP_076611341.1 | IS5-like element ISAs4 family transposase | - |
| ONZ63_RS19595 (ONZ63_19600) | 4156548..4157466 | - | 919 | Protein_3780 | IS5-like element ISAs4 family transposase | - |
| ONZ63_RS19600 (ONZ63_19605) | 4157614..4158231 | - | 618 | WP_225854306.1 | subclass B2 metallo-beta-lactamase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | aopH | 4141994..4157466 | 15472 | |
| - | inside | IScluster/Tn | - | aopH | 4141994..4159703 | 17709 | |
| - | inside | Prophage | - | aerA/act / aopH | 4141432..4157466 | 16034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14935.23 Da Isoelectric Point: 5.7146
>T264076 WP_005320982.1 NZ_CP110652:4154194-4154607 [Aeromonas salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A807Z4U5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A807Z5T0 |