Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 45441..46081 Replicon plasmid unnamed
Accession NZ_CP110651
Organism Aeromonas salmonicida strain BG

Toxin (Protein)


Gene name vagD Uniprot ID A0A807Z4U5
Locus tag ONZ60_RS23045 Protein ID WP_005320982.1
Coordinates 45668..46081 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A807Z5T0
Locus tag ONZ60_RS23040 Protein ID WP_005320985.1
Coordinates 45441..45671 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONZ60_RS23025 (ONZ60_23035) 43106..43468 - 363 WP_005321010.1 hypothetical protein -
ONZ60_RS23030 (ONZ60_23040) 43508..43954 - 447 WP_043145058.1 DNA repair protein RadC -
ONZ60_RS23035 (ONZ60_23045) 44986..45372 + 387 WP_005320988.1 hypothetical protein -
ONZ60_RS23040 (ONZ60_23050) 45441..45671 + 231 WP_005320985.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ONZ60_RS23045 (ONZ60_23055) 45668..46081 + 414 WP_005320982.1 PIN domain-containing protein Toxin
ONZ60_RS23050 (ONZ60_23060) 46207..46521 + 315 WP_225854525.1 hypothetical protein -
ONZ60_RS23055 (ONZ60_23065) 46546..47037 + 492 WP_231109927.1 hypothetical protein -
ONZ60_RS23060 (ONZ60_23070) 47059..47367 + 309 WP_005320974.1 hypothetical protein -
ONZ60_RS23065 (ONZ60_23075) 47473..47682 + 210 Protein_53 helix-turn-helix domain-containing protein -
ONZ60_RS23070 (ONZ60_23080) 47904..49447 + 1544 Protein_54 IS21-like element ISAs29 family transposase -
ONZ60_RS23075 (ONZ60_23085) 49462..50217 + 756 WP_005322068.1 IS21-like element ISAs29 family helper ATPase IstB -
ONZ60_RS23080 (ONZ60_23090) 50754..50906 + 153 WP_005322083.1 Hok/Gef family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-3.15 ascU / sycO / aopO / ati2 / ati2 / ati1 / ascL / ascK / ascJ / ascI / ascH / ascG / ascF / ascE / ascD / ascC / ascB / exsD / exsA / exsB / exsE / exsC / aopD / aopB / acrH / acrV / acrG / acrR / ascV / ascY / ascX / acr2 / acr1 / aopN / ascN / ascO / ascQ / ascR / ascS 1..101922 101922


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-42)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14935.23 Da        Isoelectric Point: 5.7146

>T264075 WP_005320982.1 NZ_CP110651:45668-46081 [Aeromonas salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8699.88 Da        Isoelectric Point: 4.7419

>AT264075 WP_005320985.1 NZ_CP110651:45441-45671 [Aeromonas salmonicida]
MRTVSIFKNGKNQAVRLPKDMEFQGVNDLEIIKNGDTITLRPARPDWFSLAECQKVDADFLQERTDVISDEGRFAL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A807Z4U5

Antitoxin

Source ID Structure
AlphaFold DB A0A807Z5T0

References