Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1504435..1505054 | Replicon | chromosome |
| Accession | NZ_CP110650 | ||
| Organism | Aeromonas salmonicida strain BG | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | ONZ60_RS07230 | Protein ID | WP_085044624.1 |
| Coordinates | 1504758..1505054 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ONZ60_RS07225 | Protein ID | WP_085044625.1 |
| Coordinates | 1504435..1504755 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONZ60_RS07205 (ONZ60_07205) | 1499504..1500631 | - | 1128 | WP_005312969.1 | succinyl-diaminopimelate desuccinylase | - |
| ONZ60_RS07210 (ONZ60_07210) | 1500651..1501001 | - | 351 | WP_005312972.1 | ArsC family reductase | - |
| ONZ60_RS07215 (ONZ60_07215) | 1501218..1502129 | - | 912 | WP_011898932.1 | LysR family transcriptional regulator | - |
| ONZ60_RS07220 (ONZ60_07220) | 1502849..1504216 | - | 1368 | WP_085044626.1 | hypothetical protein | - |
| ONZ60_RS07225 (ONZ60_07225) | 1504435..1504755 | - | 321 | WP_085044625.1 | putative addiction module antidote protein | Antitoxin |
| ONZ60_RS07230 (ONZ60_07230) | 1504758..1505054 | - | 297 | WP_085044624.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONZ60_RS07235 (ONZ60_07235) | 1505775..1506473 | - | 699 | WP_085044623.1 | phage virion morphogenesis protein | - |
| ONZ60_RS07240 (ONZ60_07240) | 1506485..1508098 | - | 1614 | WP_085044622.1 | hypothetical protein | - |
| ONZ60_RS07245 (ONZ60_07245) | 1508095..1508643 | - | 549 | WP_085044621.1 | hypothetical protein | - |
| ONZ60_RS07250 (ONZ60_07250) | 1508640..1509521 | - | 882 | WP_085044620.1 | hypothetical protein | - |
| ONZ60_RS07255 (ONZ60_07255) | 1509518..1509754 | - | 237 | WP_139804925.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1502849..1535265 | 32416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11025.77 Da Isoelectric Point: 10.1760
>T264074 WP_085044624.1 NZ_CP110650:c1505054-1504758 [Aeromonas salmonicida]
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|