Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1497891..1498510 | Replicon | chromosome |
Accession | NZ_CP110648 | ||
Organism | Aeromonas salmonicida strain YK |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | ONZ67_RS07165 | Protein ID | WP_085044624.1 |
Coordinates | 1498214..1498510 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ONZ67_RS07160 | Protein ID | WP_085044625.1 |
Coordinates | 1497891..1498211 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONZ67_RS07140 (ONZ67_07140) | 1492960..1494087 | - | 1128 | WP_005312969.1 | succinyl-diaminopimelate desuccinylase | - |
ONZ67_RS07145 (ONZ67_07145) | 1494107..1494457 | - | 351 | WP_005312972.1 | ArsC family reductase | - |
ONZ67_RS07150 (ONZ67_07150) | 1494674..1495585 | - | 912 | WP_011898932.1 | LysR family transcriptional regulator | - |
ONZ67_RS07155 (ONZ67_07155) | 1496305..1497672 | - | 1368 | WP_085044626.1 | hypothetical protein | - |
ONZ67_RS07160 (ONZ67_07160) | 1497891..1498211 | - | 321 | WP_085044625.1 | putative addiction module antidote protein | Antitoxin |
ONZ67_RS07165 (ONZ67_07165) | 1498214..1498510 | - | 297 | WP_085044624.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONZ67_RS07170 (ONZ67_07170) | 1499231..1499929 | - | 699 | WP_085044623.1 | phage virion morphogenesis protein | - |
ONZ67_RS07175 (ONZ67_07175) | 1499941..1501554 | - | 1614 | WP_085044622.1 | hypothetical protein | - |
ONZ67_RS07180 (ONZ67_07180) | 1501551..1502099 | - | 549 | WP_085044621.1 | hypothetical protein | - |
ONZ67_RS07185 (ONZ67_07185) | 1502096..1502977 | - | 882 | WP_085044620.1 | hypothetical protein | - |
ONZ67_RS07190 (ONZ67_07190) | 1502974..1503210 | - | 237 | WP_139804925.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1496305..1528721 | 32416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11025.77 Da Isoelectric Point: 10.1760
>T264073 WP_085044624.1 NZ_CP110648:c1498510-1498214 [Aeromonas salmonicida]
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|