Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4168646..4169265 Replicon chromosome
Accession NZ_CP110638
Organism Klebsiella pneumoniae strain K201054

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OO068_RS21490 Protein ID WP_002892050.1
Coordinates 4169047..4169265 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OO068_RS21485 Protein ID WP_002892066.1
Coordinates 4168646..4169020 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO068_RS21475 4163798..4164991 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OO068_RS21480 4165014..4168160 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OO068_RS21485 4168646..4169020 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OO068_RS21490 4169047..4169265 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OO068_RS21495 4169424..4169990 + 567 WP_002892030.1 maltose O-acetyltransferase -
OO068_RS21500 4169962..4170102 - 141 WP_004147370.1 hypothetical protein -
OO068_RS21505 4170123..4170593 + 471 WP_002892026.1 YlaC family protein -
OO068_RS21510 4170568..4172019 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OO068_RS21515 4172120..4172818 + 699 WP_032414604.1 GNAT family protein -
OO068_RS21520 4172815..4172955 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OO068_RS21525 4172955..4173218 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T264063 WP_002892050.1 NZ_CP110638:4169047-4169265 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT264063 WP_002892066.1 NZ_CP110638:4168646-4169020 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References