Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 199777..200516 | Replicon | chromosome |
Accession | NZ_CP110638 | ||
Organism | Klebsiella pneumoniae strain K201054 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | OO068_RS01960 | Protein ID | WP_021312536.1 |
Coordinates | 200031..200516 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OO068_RS01955 | Protein ID | WP_003026799.1 |
Coordinates | 199777..200043 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO068_RS01940 | 195280..197349 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
OO068_RS01945 | 197646..199015 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
OO068_RS01950 | 199216..199644 | + | 429 | WP_004901287.1 | GFA family protein | - |
OO068_RS01955 | 199777..200043 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OO068_RS01960 | 200031..200516 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
OO068_RS01965 | 200860..201012 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
OO068_RS01970 | 201314..202933 | + | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
OO068_RS01975 | 203032..203244 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
OO068_RS01980 | 203497..203787 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
OO068_RS01985 | 204033..205388 | - | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 198290..199015 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T264054 WP_021312536.1 NZ_CP110638:200031-200516 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|