Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 136481..137391 Replicon plasmid pA
Accession NZ_CP110637
Organism Klebsiella pneumoniae strain K201054

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OO068_RS00755 Protein ID WP_004026354.1
Coordinates 136921..137391 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OO068_RS00750 Protein ID WP_004026357.1
Coordinates 136481..136924 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO068_RS00720 131499..132020 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
OO068_RS00725 132017..132970 + 954 Protein_144 fec operon regulator FecR -
OO068_RS00730 133057..135183 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
OO068_RS00735 135258..135377 + 120 Protein_146 Fe3+-citrate ABC transporter substrate-binding protein -
OO068_RS00740 135558..135779 + 222 WP_004213643.1 DUF2188 domain-containing protein -
OO068_RS00745 135877..136380 + 504 Protein_148 DUF4113 domain-containing protein -
OO068_RS00750 136481..136924 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OO068_RS00755 136921..137391 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OO068_RS00760 137874..138571 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OO068_RS00765 139634..139882 - 249 Protein_152 integrase core domain-containing protein -
OO068_RS00770 139960..141071 + 1112 WP_105002552.1 IS3 family transposase -
OO068_RS00775 141438..142280 - 843 WP_048291837.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN 1..204301 204301


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T264053 WP_004026354.1 NZ_CP110637:136921-137391 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT264053 WP_004026357.1 NZ_CP110637:136481-136924 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References