Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 111355..112106 | Replicon | plasmid pA |
| Accession | NZ_CP110637 | ||
| Organism | Klebsiella pneumoniae strain K201054 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | OO068_RS00620 | Protein ID | WP_048333033.1 |
| Coordinates | 111624..112106 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | OO068_RS00615 | Protein ID | WP_004902250.1 |
| Coordinates | 111355..111633 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO068_RS00590 | 107416..107898 | + | 483 | WP_181947792.1 | hypothetical protein | - |
| OO068_RS00600 | 109353..109667 | - | 315 | WP_048291862.1 | hypothetical protein | - |
| OO068_RS00605 | 110572..110913 | + | 342 | WP_032437747.1 | hypothetical protein | - |
| OO068_RS00610 | 111021..111233 | + | 213 | WP_016946198.1 | hypothetical protein | - |
| OO068_RS00615 | 111355..111633 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| OO068_RS00620 | 111624..112106 | + | 483 | WP_048333033.1 | GNAT family N-acetyltransferase | Toxin |
| OO068_RS00625 | 112523..113491 | + | 969 | WP_004225014.1 | IS5 family transposase | - |
| OO068_RS00630 | 113863..114186 | + | 324 | WP_004902375.1 | hypothetical protein | - |
| OO068_RS00635 | 114335..115023 | + | 689 | Protein_126 | IS1 family transposase | - |
| OO068_RS00640 | 115034..115300 | + | 267 | Protein_127 | IS3 family transposase | - |
| OO068_RS00645 | 115370..116023 | - | 654 | WP_023302796.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN | 1..204301 | 204301 | |
| - | inside | IScluster/Tn | - | pla | 103583..115192 | 11609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17708.53 Da Isoelectric Point: 8.9130
>T264052 WP_048333033.1 NZ_CP110637:111624-112106 [Klebsiella pneumoniae]
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|