Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 70903..71813 | Replicon | plasmid pA |
| Accession | NZ_CP110637 | ||
| Organism | Klebsiella pneumoniae strain K201054 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OO068_RS00380 | Protein ID | WP_117107731.1 |
| Coordinates | 70903..71373 (-) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OO068_RS00385 | Protein ID | WP_053065126.1 |
| Coordinates | 71370..71813 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO068_RS00350 | 66191..66421 | - | 231 | WP_047732352.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| OO068_RS00355 | 67037..67366 | + | 330 | WP_053065107.1 | hypothetical protein | - |
| OO068_RS00360 | 67400..68221 | + | 822 | WP_053065158.1 | hypothetical protein | - |
| OO068_RS00365 | 68218..69003 | + | 786 | WP_117107721.1 | site-specific integrase | - |
| OO068_RS00370 | 69292..70323 | - | 1032 | WP_135778203.1 | IS630-like element ISEc33 family transposase | - |
| OO068_RS00375 | 70534..70722 | + | 189 | WP_023329006.1 | hypothetical protein | - |
| OO068_RS00380 | 70903..71373 | - | 471 | WP_117107731.1 | RES family NAD+ phosphorylase | Toxin |
| OO068_RS00385 | 71370..71813 | - | 444 | WP_053065126.1 | DUF2384 domain-containing protein | Antitoxin |
| OO068_RS00390 | 71935..72601 | - | 667 | Protein_77 | DUF4113 domain-containing protein | - |
| OO068_RS00395 | 72783..73869 | - | 1087 | Protein_78 | DUF2891 domain-containing protein | - |
| OO068_RS00400 | 73879..74865 | - | 987 | Protein_79 | DUF979 domain-containing protein | - |
| OO068_RS00405 | 74862..75583 | - | 722 | Protein_80 | DUF969 domain-containing protein | - |
| OO068_RS00410 | 75782..76012 | + | 231 | Protein_81 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN | 1..204301 | 204301 | |
| - | flank | IS/Tn | - | - | 69292..70323 | 1031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17391.58 Da Isoelectric Point: 4.3752
>T264051 WP_117107731.1 NZ_CP110637:c71373-70903 [Klebsiella pneumoniae]
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALGVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIQFRFDSRLKPDRK
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALGVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIQFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16394.75 Da Isoelectric Point: 9.6519
>AT264051 WP_053065126.1 NZ_CP110637:c71813-71370 [Klebsiella pneumoniae]
MKTFSLSSTPARPQCLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQCLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|