Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 65784..66421 Replicon plasmid pA
Accession NZ_CP110637
Organism Klebsiella pneumoniae strain K201054

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OO068_RS00345 Protein ID WP_117107722.1
Coordinates 65784..66194 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag OO068_RS00350 Protein ID WP_047732352.1
Coordinates 66191..66421 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO068_RS00325 61093..61851 + 759 WP_053065089.1 DeoR/GlpR family DNA-binding transcription regulator -
OO068_RS00330 61885..63066 + 1182 WP_047732340.1 MFS transporter -
OO068_RS00335 63148..63777 + 630 WP_063136851.1 DUF1349 domain-containing protein -
OO068_RS00340 64568..65638 + 1071 WP_130941442.1 hypothetical protein -
OO068_RS00345 65784..66194 - 411 WP_117107722.1 type II toxin-antitoxin system VapC family toxin Toxin
OO068_RS00350 66191..66421 - 231 WP_047732352.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OO068_RS00355 67037..67366 + 330 WP_053065107.1 hypothetical protein -
OO068_RS00360 67400..68221 + 822 WP_053065158.1 hypothetical protein -
OO068_RS00365 68218..69003 + 786 WP_117107721.1 site-specific integrase -
OO068_RS00370 69292..70323 - 1032 WP_135778203.1 IS630-like element ISEc33 family transposase -
OO068_RS00375 70534..70722 + 189 WP_023329006.1 hypothetical protein -
OO068_RS00380 70903..71373 - 471 WP_117107731.1 RES family NAD+ phosphorylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN 1..204301 204301
- flank IS/Tn - - 69292..70323 1031


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-127)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14759.95 Da        Isoelectric Point: 5.1873

>T264050 WP_117107722.1 NZ_CP110637:c66194-65784 [Klebsiella pneumoniae]
VNRIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWAELSQAAKESGPGTQNLADAFAARLDAILPWDRAAV
DATTEIKVALRMAGTPIDPNDTAIAGHAIAAGAVLVTNNVREFERVPGLALEDWVK

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.83 Da        Isoelectric Point: 4.4692

>AT264050 WP_047732352.1 NZ_CP110637:c66421-66191 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDMDFEGVSELEIIREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References