Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 52806..53431 Replicon plasmid pA
Accession NZ_CP110637
Organism Klebsiella pneumoniae strain K201054

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OO068_RS00280 Protein ID WP_047732310.1
Coordinates 52806..53204 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag OO068_RS00285 Protein ID WP_053065088.1
Coordinates 53204..53431 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO068_RS00250 48053..49489 - 1437 WP_053065155.1 coniferyl aldehyde dehydrogenase -
OO068_RS00255 50385..50495 + 111 Protein_50 DUF5431 family protein -
OO068_RS00260 50446..50565 + 120 WP_229690214.1 Hok/Gef family protein -
OO068_RS00265 50817..51074 - 258 WP_077258044.1 DUF2767 family protein -
OO068_RS00270 51515..51757 - 243 WP_130941443.1 hypothetical protein -
OO068_RS00275 52474..52809 + 336 WP_053065087.1 hypothetical protein -
OO068_RS00280 52806..53204 - 399 WP_047732310.1 tRNA(fMet)-specific endonuclease VapC Toxin
OO068_RS00285 53204..53431 - 228 WP_053065088.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OO068_RS00290 53513..53854 + 342 WP_227589995.1 transposase -
OO068_RS00295 54308..56119 + 1812 WP_047732316.1 beta-glucoside-specific PTS transporter subunit IIABC -
OO068_RS00300 56119..57582 + 1464 WP_265389986.1 family 1 glycosylhydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN 1..204301 204301


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14818.09 Da        Isoelectric Point: 9.0835

>T264049 WP_047732310.1 NZ_CP110637:c53204-52806 [Klebsiella pneumoniae]
MLRYMLDTNICIFTIKNKPEAVRVKFNLHRQRLCISTITLMELIYGAEKSSAPERNLAVVEGFAARLTVLDYDAHAATHT
GQIRAEQAKAGQPIGPYDQMIAGHARSQGLIVVTNNMREFSRVSGLRSEDWI

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8394.35 Da        Isoelectric Point: 4.3558

>AT264049 WP_053065088.1 NZ_CP110637:c53431-53204 [Klebsiella pneumoniae]
METTVFLSNRSQAVRLPKAVALPDDVKHVEIVAVGRSRIISPAGESWDAWFDGDAVTSDFMSTREQPDTQIREDF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References