Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 24142..24946 | Replicon | plasmid pA |
| Accession | NZ_CP110637 | ||
| Organism | Klebsiella pneumoniae strain K201054 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | OO068_RS00140 | Protein ID | WP_072198182.1 |
| Coordinates | 24419..24946 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | OO068_RS00135 | Protein ID | WP_048264996.1 |
| Coordinates | 24142..24411 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO068_RS00120 | 19395..20387 | + | 993 | WP_135778242.1 | ABC transporter substrate-binding protein | - |
| OO068_RS00125 | 20384..21130 | + | 747 | WP_048978068.1 | ABC transporter permease | - |
| OO068_RS00130 | 21145..23508 | + | 2364 | WP_048264995.1 | hypothetical protein | - |
| OO068_RS00135 | 24142..24411 | + | 270 | WP_048264996.1 | DUF1778 domain-containing protein | Antitoxin |
| OO068_RS00140 | 24419..24946 | + | 528 | WP_072198182.1 | GNAT family N-acetyltransferase | Toxin |
| OO068_RS00145 | 25030..25338 | + | 309 | WP_063444628.1 | hypothetical protein | - |
| OO068_RS00150 | 25389..26086 | + | 698 | WP_265389984.1 | IS1 family transposase | - |
| OO068_RS00155 | 26398..27300 | - | 903 | WP_048265000.1 | LysR family transcriptional regulator | - |
| OO068_RS00160 | 27398..28006 | + | 609 | WP_023345578.1 | short chain dehydrogenase | - |
| OO068_RS00165 | 28125..29306 | - | 1182 | WP_117107737.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla / rmpA / rmpA / iroN / iroD / iroC / iroB / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / iroN | 1..204301 | 204301 | |
| - | flank | IS/Tn | - | - | 25583..26086 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 20078.04 Da Isoelectric Point: 5.7389
>T264048 WP_072198182.1 NZ_CP110637:24419-24946 [Klebsiella pneumoniae]
VMQELAIEMINDEFDYDIGEFDCGEETLNTFLKDHLKRQHDGQILKGYVLVTKEQKPKLLGYYTLSGSCFERKMLPSKTQ
QRKIPYQNAPSITLGRLAIDKSIQGQGWGELLVTHAMNVVWDASKAVGIYGLFVEALNDKAKRFYTRLDFIQLVGENSNL
LFYPTKSIEKIFTEE
VMQELAIEMINDEFDYDIGEFDCGEETLNTFLKDHLKRQHDGQILKGYVLVTKEQKPKLLGYYTLSGSCFERKMLPSKTQ
QRKIPYQNAPSITLGRLAIDKSIQGQGWGELLVTHAMNVVWDASKAVGIYGLFVEALNDKAKRFYTRLDFIQLVGENSNL
LFYPTKSIEKIFTEE
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|