Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1400558..1401474 | Replicon | chromosome |
Accession | NZ_CP110634 | ||
Organism | Bacillus subtilis strain MG-1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | OOZ27_RS07605 | Protein ID | WP_015715744.1 |
Coordinates | 1400728..1401474 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | OOZ27_RS07600 | Protein ID | WP_015715743.1 |
Coordinates | 1400558..1400728 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOZ27_RS07565 (1397417) | 1397417..1397746 | + | 330 | WP_003232660.1 | XkdW family protein | - |
OOZ27_RS07570 (1397743) | 1397743..1397907 | + | 165 | WP_015715740.1 | XkdX family protein | - |
OOZ27_RS07575 (1397951) | 1397951..1398790 | + | 840 | WP_015715741.1 | phage-like element PBSX protein XepA | - |
OOZ27_RS07580 (1398843) | 1398843..1399112 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
OOZ27_RS07585 (1399125) | 1399125..1399388 | + | 264 | WP_014479566.1 | phage holin | - |
OOZ27_RS07590 (1399401) | 1399401..1400294 | + | 894 | WP_015715742.1 | N-acetylmuramoyl-L-alanine amidase | - |
OOZ27_RS07595 (1400332) | 1400332..1400472 | - | 141 | WP_144460135.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
OOZ27_RS07600 (1400558) | 1400558..1400728 | - | 171 | WP_015715743.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
OOZ27_RS07605 (1400728) | 1400728..1401474 | - | 747 | WP_015715744.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
OOZ27_RS07610 (1401584) | 1401584..1402585 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
OOZ27_RS07615 (1402598) | 1402598..1403215 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
OOZ27_RS07620 (1403491) | 1403491..1404807 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
OOZ27_RS07625 (1405196) | 1405196..1406146 | + | 951 | WP_015715745.1 | ring-cleaving dioxygenase | - |
OOZ27_RS07630 (1406255) | 1406255..1406350 | + | 96 | Protein_1441 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29043.47 Da Isoelectric Point: 4.6191
>T264038 WP_015715744.1 NZ_CP110634:c1401474-1400728 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|