Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 571735..572371 | Replicon | chromosome |
Accession | NZ_CP110634 | ||
Organism | Bacillus subtilis strain MG-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OOZ27_RS03015 | Protein ID | WP_003156187.1 |
Coordinates | 572021..572371 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | OOZ27_RS03010 | Protein ID | WP_003225183.1 |
Coordinates | 571735..572016 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOZ27_RS02990 (568094) | 568094..568693 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
OOZ27_RS02995 (568788) | 568788..569153 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
OOZ27_RS03000 (569319) | 569319..570335 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
OOZ27_RS03005 (570450) | 570450..571619 | + | 1170 | WP_003234284.1 | alanine racemase | - |
OOZ27_RS03010 (571735) | 571735..572016 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OOZ27_RS03015 (572021) | 572021..572371 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OOZ27_RS03020 (572486) | 572486..573310 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
OOZ27_RS03025 (573315) | 573315..573680 | + | 366 | WP_015715277.1 | RsbT antagonist protein RsbS | - |
OOZ27_RS03030 (573684) | 573684..574085 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
OOZ27_RS03035 (574097) | 574097..575104 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
OOZ27_RS03040 (575166) | 575166..575495 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
OOZ27_RS03045 (575492) | 575492..575974 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
OOZ27_RS03050 (575940) | 575940..576728 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
OOZ27_RS03055 (576728) | 576728..577327 | + | 600 | WP_265392660.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T264037 WP_003156187.1 NZ_CP110634:572021-572371 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|