Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-RelB |
Location | 4046797..4047314 | Replicon | chromosome |
Accession | NZ_CP110629 | ||
Organism | Marinimicrobium sp. C6131 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OOT55_RS17040 | Protein ID | WP_265367030.1 |
Coordinates | 4046797..4047066 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OOT55_RS17045 | Protein ID | WP_024462286.1 |
Coordinates | 4047063..4047314 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOT55_RS17025 (OOT55_17025) | 4042621..4044327 | - | 1707 | WP_265367027.1 | DUF5666 domain-containing protein | - |
OOT55_RS17030 (OOT55_17030) | 4044496..4045275 | - | 780 | WP_265367028.1 | hypothetical protein | - |
OOT55_RS17035 (OOT55_17035) | 4045369..4046793 | + | 1425 | WP_265367029.1 | GTPase domain-containing protein | - |
OOT55_RS17040 (OOT55_17040) | 4046797..4047066 | - | 270 | WP_265367030.1 | Txe/YoeB family addiction module toxin | Toxin |
OOT55_RS17045 (OOT55_17045) | 4047063..4047314 | - | 252 | WP_024462286.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OOT55_RS17050 (OOT55_17050) | 4048053..4048907 | - | 855 | WP_265367031.1 | hypothetical protein | - |
OOT55_RS17055 (OOT55_17055) | 4049182..4049397 | + | 216 | WP_265367032.1 | AlpA family transcriptional regulator | - |
OOT55_RS17060 (OOT55_17060) | 4049617..4050195 | + | 579 | WP_265367033.1 | AHH domain-containing protein | - |
OOT55_RS17065 (OOT55_17065) | 4050255..4050773 | + | 519 | WP_265367034.1 | hypothetical protein | - |
OOT55_RS17070 (OOT55_17070) | 4051118..4051816 | + | 699 | WP_265367035.1 | inovirus-type Gp2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10599.20 Da Isoelectric Point: 9.9171
>T264035 WP_265367030.1 NZ_CP110629:c4047066-4046797 [Marinimicrobium sp. C6131]
MILAWTSTAWSEYEYWQGTDKKTVKRINKLIQETMRTPFDGSGKPEPLKHGLKGYWSRRIDREHRLVYKLKGEGPDATLL
IIQCRFHYE
MILAWTSTAWSEYEYWQGTDKKTVKRINKLIQETMRTPFDGSGKPEPLKHGLKGYWSRRIDREHRLVYKLKGEGPDATLL
IIQCRFHYE
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|