Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 2704801..2705332 | Replicon | chromosome |
Accession | NZ_CP110623 | ||
Organism | Prosthecochloris sp. SCSIO W1101 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OO006_RS12535 | Protein ID | WP_265371447.1 |
Coordinates | 2704801..2705082 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | OO006_RS12540 | Protein ID | WP_265371448.1 |
Coordinates | 2705069..2705332 (-) | Length | 88 a.a. |
Genomic Context
Location: 2707080..2707496 (417 bp)
Type: Others
Protein ID: WP_265371452.1
Type: Others
Protein ID: WP_265371452.1
Location: 2701693..2702946 (1254 bp)
Type: Others
Protein ID: WP_265371445.1
Type: Others
Protein ID: WP_265371445.1
Location: 2703655..2704377 (723 bp)
Type: Others
Protein ID: WP_265371446.1
Type: Others
Protein ID: WP_265371446.1
Location: 2704801..2705082 (282 bp)
Type: Toxin
Protein ID: WP_265371447.1
Type: Toxin
Protein ID: WP_265371447.1
Location: 2705069..2705332 (264 bp)
Type: Antitoxin
Protein ID: WP_265371448.1
Type: Antitoxin
Protein ID: WP_265371448.1
Location: 2705528..2705878 (351 bp)
Type: Others
Protein ID: WP_265371449.1
Type: Others
Protein ID: WP_265371449.1
Location: 2705875..2706141 (267 bp)
Type: Others
Protein ID: WP_265371450.1
Type: Others
Protein ID: WP_265371450.1
Location: 2706601..2707092 (492 bp)
Type: Others
Protein ID: WP_265371451.1
Type: Others
Protein ID: WP_265371451.1
Location: 2707734..2708243 (510 bp)
Type: Others
Protein ID: WP_265371453.1
Type: Others
Protein ID: WP_265371453.1
Location: 2708382..2708702 (321 bp)
Type: Others
Protein ID: WP_265371454.1
Type: Others
Protein ID: WP_265371454.1
Location: 2708800..2709573 (774 bp)
Type: Others
Protein ID: WP_265371455.1
Type: Others
Protein ID: WP_265371455.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO006_RS12525 (OO006_12525) | 2701693..2702946 | - | 1254 | WP_265371445.1 | glycosyltransferase | - |
OO006_RS12530 (OO006_12530) | 2703655..2704377 | - | 723 | WP_265371446.1 | DUF169 domain-containing protein | - |
OO006_RS12535 (OO006_12535) | 2704801..2705082 | - | 282 | WP_265371447.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OO006_RS12540 (OO006_12540) | 2705069..2705332 | - | 264 | WP_265371448.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OO006_RS12545 (OO006_12545) | 2705528..2705878 | - | 351 | WP_265371449.1 | hypothetical protein | - |
OO006_RS12550 (OO006_12550) | 2705875..2706141 | - | 267 | WP_265371450.1 | hypothetical protein | - |
OO006_RS12555 (OO006_12555) | 2706601..2707092 | - | 492 | WP_265371451.1 | GNAT family N-acetyltransferase | - |
OO006_RS12560 (OO006_12560) | 2707080..2707496 | + | 417 | WP_265371452.1 | hypothetical protein | - |
OO006_RS12565 (OO006_12565) | 2707734..2708243 | - | 510 | WP_265371453.1 | N-acetyltransferase | - |
OO006_RS12570 (OO006_12570) | 2708382..2708702 | - | 321 | WP_265371454.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OO006_RS12575 (OO006_12575) | 2708800..2709573 | - | 774 | WP_265371455.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10905.74 Da Isoelectric Point: 10.1873
>T264034 WP_265371447.1 NZ_CP110623:c2705082-2704801 [Prosthecochloris sp. SCSIO W1101]
MRTIKYTSKFKSDYKREQKGRHGKKLERLLKPVISLLVEDQALPKNLVDHPLSGRWKDCRDCHIKPDLVLIYRKPDDQNL
ELVRLGSHSELGL
MRTIKYTSKFKSDYKREQKGRHGKKLERLLKPVISLLVEDQALPKNLVDHPLSGRWKDCRDCHIKPDLVLIYRKPDDQNL
ELVRLGSHSELGL
Download Length: 282 bp