Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2175187..2175797 | Replicon | chromosome |
| Accession | NZ_CP110622 | ||
| Organism | Prosthecochloris sp. SCSIO W1103 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OO005_RS09985 | Protein ID | WP_110023745.1 |
| Coordinates | 2175187..2175492 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OO005_RS09990 | Protein ID | WP_110023746.1 |
| Coordinates | 2175489..2175797 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO005_RS09975 (OO005_09975) | 2170437..2173205 | + | 2769 | WP_265354097.1 | phosphoenolpyruvate carboxylase | - |
| OO005_RS09980 (OO005_09980) | 2173286..2174842 | + | 1557 | WP_265354098.1 | YifB family Mg chelatase-like AAA ATPase | - |
| OO005_RS09985 (OO005_09985) | 2175187..2175492 | + | 306 | WP_110023745.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OO005_RS09990 (OO005_09990) | 2175489..2175797 | + | 309 | WP_110023746.1 | putative addiction module antidote protein | Antitoxin |
| OO005_RS09995 (OO005_09995) | 2175963..2176382 | + | 420 | WP_110023747.1 | nuclear transport factor 2 family protein | - |
| OO005_RS10000 (OO005_10000) | 2176470..2176991 | + | 522 | WP_110023748.1 | class IV adenylate cyclase | - |
| OO005_RS10005 (OO005_10005) | 2177051..2177464 | + | 414 | WP_265354099.1 | GNAT family N-acetyltransferase | - |
| OO005_RS10010 (OO005_10010) | 2177803..2178648 | + | 846 | WP_265354100.1 | hypothetical protein | - |
| OO005_RS10015 (OO005_10015) | 2179080..2179631 | + | 552 | WP_265354101.1 | DUF2059 domain-containing protein | - |
| OO005_RS10020 (OO005_10020) | 2179712..2180176 | + | 465 | WP_265354102.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11500.16 Da Isoelectric Point: 10.6525
>T264033 WP_110023745.1 NZ_CP110622:2175187-2175492 [Prosthecochloris sp. SCSIO W1103]
MNTFIRSNEFDRWLSNLSDQKAKARILARLRSAMHGNFGDCEPVGEGVSEMRIHVGAGYRVYYTRTGTTVYFLLGGGSKS
TQRKDIKNLKKLARKIKETEQ
MNTFIRSNEFDRWLSNLSDQKAKARILARLRSAMHGNFGDCEPVGEGVSEMRIHVGAGYRVYYTRTGTTVYFLLGGGSKS
TQRKDIKNLKKLARKIKETEQ
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|