Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 731673..732274 | Replicon | chromosome |
Accession | NZ_CP110621 | ||
Organism | Pasteurella multocida strain P504190 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OO004_RS03455 | Protein ID | WP_078819687.1 |
Coordinates | 731960..732274 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OO004_RS03450 | Protein ID | WP_078819686.1 |
Coordinates | 731673..731963 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO004_RS03420 (OO004_03420) | 726898..727599 | - | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
OO004_RS03425 (OO004_03425) | 727658..728110 | - | 453 | WP_014390720.1 | hypothetical protein | - |
OO004_RS03430 (OO004_03430) | 728160..728357 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
OO004_RS03435 (OO004_03435) | 728481..729158 | + | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
OO004_RS03440 (OO004_03440) | 729369..731213 | + | 1845 | WP_265362803.1 | DEAD/DEAH box helicase family protein | - |
OO004_RS03445 (OO004_03445) | 731243..731647 | + | 405 | WP_146024473.1 | hypothetical protein | - |
OO004_RS03450 (OO004_03450) | 731673..731963 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
OO004_RS03455 (OO004_03455) | 731960..732274 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OO004_RS03460 (OO004_03460) | 732732..732959 | + | 228 | WP_099821843.1 | hypothetical protein | - |
OO004_RS03475 (OO004_03475) | 733855..734046 | + | 192 | WP_014390714.1 | hypothetical protein | - |
OO004_RS03480 (OO004_03480) | 734021..734398 | + | 378 | WP_014390713.1 | hypothetical protein | - |
OO004_RS03485 (OO004_03485) | 734509..735345 | + | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
OO004_RS03490 (OO004_03490) | 735630..736286 | + | 657 | WP_014390711.1 | Bro-N domain-containing protein | - |
OO004_RS03495 (OO004_03495) | 736690..737058 | + | 369 | Protein_661 | Bro-N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 694225..747168 | 52943 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264030 WP_078819687.1 NZ_CP110621:c732274-731960 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|