Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 883773..884347 | Replicon | chromosome |
Accession | NZ_CP110620 | ||
Organism | Pasteurella multocida strain P5041881 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A849CFF7 |
Locus tag | OO003_RS04175 | Protein ID | WP_014667974.1 |
Coordinates | 884063..884347 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A849CG04 |
Locus tag | OO003_RS04170 | Protein ID | WP_014391174.1 |
Coordinates | 883773..884066 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO003_RS04150 (OO003_04150) | 878939..880030 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
OO003_RS04155 (OO003_04155) | 880379..882169 | + | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
OO003_RS04160 (OO003_04160) | 882214..882681 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
OO003_RS04165 (OO003_04165) | 882699..883376 | + | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
OO003_RS04170 (OO003_04170) | 883773..884066 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
OO003_RS04175 (OO003_04175) | 884063..884347 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
OO003_RS04185 (OO003_04185) | 885641..885902 | - | 262 | Protein_794 | hypothetical protein | - |
OO003_RS04190 (OO003_04190) | 886246..886398 | - | 153 | WP_014391177.1 | hypothetical protein | - |
OO003_RS04195 (OO003_04195) | 886698..887363 | - | 666 | WP_265362905.1 | hypothetical protein | - |
OO003_RS04200 (OO003_04200) | 887378..888886 | - | 1509 | WP_265362907.1 | S8 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 885641..885802 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T264028 WP_014667974.1 NZ_CP110620:c884347-884063 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CFF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CG04 |