Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3831987..3832672 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF49 |
Locus tag | M7V54_RS18085 | Protein ID | WP_003917170.1 |
Coordinates | 3832262..3832672 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M7V54_RS18080 | Protein ID | WP_003912220.1 |
Coordinates | 3831987..3832265 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS18060 | 3827976..3829577 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
M7V54_RS18065 | 3829594..3830298 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
M7V54_RS18070 | 3830416..3830982 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
M7V54_RS18075 | 3831044..3831931 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
M7V54_RS18080 | 3831987..3832265 | + | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M7V54_RS18085 | 3832262..3832672 | + | 411 | WP_003917170.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS18090 | 3832705..3834441 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
M7V54_RS18095 | 3834497..3835624 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
M7V54_RS18100 | 3835644..3837233 | - | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14669.76 Da Isoelectric Point: 5.1784
>T264026 WP_003917170.1 NZ_CP110619:3832262-3832672 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVESMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVESMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|