Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3711619..3712293 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag M7V54_RS17625 Protein ID WP_003417282.1
Coordinates 3711619..3712047 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag M7V54_RS17630 Protein ID WP_003417286.1
Coordinates 3712051..3712293 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS17600 3707441..3707842 - 402 WP_003417264.1 cytidine deaminase -
M7V54_RS17605 3708079..3708417 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
M7V54_RS17610 3708414..3708848 + 435 WP_009936281.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
M7V54_RS17615 3708977..3710749 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
M7V54_RS17620 3710749..3711540 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
M7V54_RS17625 3711619..3712047 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS17630 3712051..3712293 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
M7V54_RS17635 3712415..3713029 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
M7V54_RS17640 3713026..3713691 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
M7V54_RS17645 3713692..3714225 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
M7V54_RS17650 3714222..3714356 - 135 Protein_3486 4a-hydroxytetrahydrobiopterin dehydratase -
M7V54_RS17655 3714410..3715671 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T264023 WP_003417282.1 NZ_CP110619:c3712047-3711619 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT264023 WP_003417286.1 NZ_CP110619:c3712293-3712051 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References