Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3711619..3712293 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | M7V54_RS17625 | Protein ID | WP_003417282.1 |
Coordinates | 3711619..3712047 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | M7V54_RS17630 | Protein ID | WP_003417286.1 |
Coordinates | 3712051..3712293 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS17600 | 3707441..3707842 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
M7V54_RS17605 | 3708079..3708417 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
M7V54_RS17610 | 3708414..3708848 | + | 435 | WP_009936281.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
M7V54_RS17615 | 3708977..3710749 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
M7V54_RS17620 | 3710749..3711540 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
M7V54_RS17625 | 3711619..3712047 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS17630 | 3712051..3712293 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
M7V54_RS17635 | 3712415..3713029 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
M7V54_RS17640 | 3713026..3713691 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
M7V54_RS17645 | 3713692..3714225 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
M7V54_RS17650 | 3714222..3714356 | - | 135 | Protein_3486 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
M7V54_RS17655 | 3714410..3715671 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T264023 WP_003417282.1 NZ_CP110619:c3712047-3711619 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |