Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3186777..3187464 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | M7V54_RS15245 | Protein ID | WP_003414624.1 |
Coordinates | 3187021..3187464 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | M7V54_RS15240 | Protein ID | WP_003414620.1 |
Coordinates | 3186777..3187034 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS15220 | 3182097..3182951 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
M7V54_RS15225 | 3183007..3184170 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
M7V54_RS15230 | 3184187..3185401 | - | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
M7V54_RS15235 | 3185409..3186650 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
M7V54_RS15240 | 3186777..3187034 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M7V54_RS15245 | 3187021..3187464 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS15250 | 3187544..3188206 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
M7V54_RS15255 | 3188302..3188493 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
M7V54_RS15260 | 3188825..3190573 | + | 1749 | WP_178121166.1 | cytochrome c biogenesis protein DipZ | - |
M7V54_RS15265 | 3190669..3191250 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
M7V54_RS15270 | 3191350..3191616 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T264021 WP_003414624.1 NZ_CP110619:3187021-3187464 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|