264019

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3140259..3140863 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag M7V54_RS15015 Protein ID WP_003414492.1
Coordinates 3140259..3140651 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P71622
Locus tag M7V54_RS15020 Protein ID WP_003912003.1
Coordinates 3140648..3140863 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS14985 3135409..3136197 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
M7V54_RS14990 3136531..3137076 - 546 WP_003913758.1 DUF1802 family protein -
M7V54_RS14995 3137348..3138232 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M7V54_RS15000 3138235..3139122 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
M7V54_RS15005 3139427..3139972 - 546 WP_003899500.1 DUF1802 family protein -
M7V54_RS15010 3139969..3140238 - 270 WP_003414489.1 DUF2277 family protein -
M7V54_RS15015 3140259..3140651 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS15020 3140648..3140863 - 216 WP_003912003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M7V54_RS15025 3140910..3141659 + 750 WP_003414497.1 enoyl-CoA hydratase -
M7V54_RS15030 3141738..3142820 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
M7V54_RS15035 3142813..3144123 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
M7V54_RS15040 3144126..3144953 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
M7V54_RS15045 3144950..3145861 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T264019 WP_003414492.1 NZ_CP110619:c3140651-3140259 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7483.50 Da        Isoelectric Point: 4.9732

>AT264019 WP_003912003.1 NZ_CP110619:c3140863-3140648 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAADDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB P71622

References