Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 3140259..3140863 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | M7V54_RS15015 | Protein ID | WP_003414492.1 |
| Coordinates | 3140259..3140651 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P71622 |
| Locus tag | M7V54_RS15020 | Protein ID | WP_003912003.1 |
| Coordinates | 3140648..3140863 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS14985 | 3135409..3136197 | - | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
| M7V54_RS14990 | 3136531..3137076 | - | 546 | WP_003913758.1 | DUF1802 family protein | - |
| M7V54_RS14995 | 3137348..3138232 | - | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M7V54_RS15000 | 3138235..3139122 | - | 888 | WP_003414414.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| M7V54_RS15005 | 3139427..3139972 | - | 546 | WP_003899500.1 | DUF1802 family protein | - |
| M7V54_RS15010 | 3139969..3140238 | - | 270 | WP_003414489.1 | DUF2277 family protein | - |
| M7V54_RS15015 | 3140259..3140651 | - | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M7V54_RS15020 | 3140648..3140863 | - | 216 | WP_003912003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M7V54_RS15025 | 3140910..3141659 | + | 750 | WP_003414497.1 | enoyl-CoA hydratase | - |
| M7V54_RS15030 | 3141738..3142820 | - | 1083 | WP_003414499.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| M7V54_RS15035 | 3142813..3144123 | - | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| M7V54_RS15040 | 3144126..3144953 | - | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| M7V54_RS15045 | 3144950..3145861 | - | 912 | WP_003414505.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T264019 WP_003414492.1 NZ_CP110619:c3140651-3140259 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P71622 |