Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3113806..3114376 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | M7V54_RS14870 | Protein ID | WP_003414166.1 |
| Coordinates | 3113806..3114162 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | M7V54_RS14875 | Protein ID | WP_003901465.1 |
| Coordinates | 3114146..3114376 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS14850 | 3109258..3110946 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| M7V54_RS14855 | 3110950..3111276 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| M7V54_RS14860 | 3111449..3112036 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
| M7V54_RS14865 | 3112055..3113704 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| M7V54_RS14870 | 3113806..3114162 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| M7V54_RS14875 | 3114146..3114376 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| M7V54_RS14880 | 3114419..3115462 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| M7V54_RS14885 | 3115461..3115928 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| M7V54_RS14890 | 3116104..3116358 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| M7V54_RS14895 | 3116506..3116910 | + | 405 | WP_009938577.1 | hypothetical protein | - |
| M7V54_RS14900 | 3116907..3117098 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| M7V54_RS14905 | 3117315..3117575 | + | 261 | Protein_2942 | transposase | - |
| M7V54_RS14910 | 3118685..3118942 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| M7V54_RS14915 | 3119047..3119358 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T264017 WP_003414166.1 NZ_CP110619:c3114162-3113806 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|