Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3074222..3074909 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag M7V54_RS14650 Protein ID WP_003414064.1
Coordinates 3074514..3074909 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag M7V54_RS14645 Protein ID WP_003414061.1
Coordinates 3074222..3074488 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS14615 3069861..3070763 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
M7V54_RS14620 3070832..3071584 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
M7V54_RS14625 3071611..3071748 - 138 Protein_2886 type II toxin-antitoxin system VapC family toxin -
M7V54_RS14630 3071828..3072103 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
M7V54_RS14635 3072100..3073722 - 1623 WP_003906897.1 class I SAM-dependent DNA methyltransferase -
M7V54_RS14640 3073809..3074225 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
M7V54_RS14645 3074222..3074488 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M7V54_RS14650 3074514..3074909 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS14655 3074906..3075175 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
M7V54_RS14660 3075185..3076279 - 1095 WP_003414068.1 restriction endonuclease subunit S -
M7V54_RS14665 3076276..3076695 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
M7V54_RS14670 3076694..3076768 + 75 Protein_2895 hypothetical protein -
M7V54_RS14675 3076769..3077248 - 480 WP_003414073.1 dihydrofolate reductase -
M7V54_RS14680 3077319..3078119 - 801 WP_003911953.1 thymidylate synthase -
M7V54_RS14685 3078275..3079012 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T264016 WP_003414064.1 NZ_CP110619:c3074909-3074514 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT264016 WP_003414061.1 NZ_CP110619:c3074488-3074222 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References