Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3073809..3074488 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | M7V54_RS14640 | Protein ID | WP_003414059.1 |
Coordinates | 3073809..3074225 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | M7V54_RS14645 | Protein ID | WP_003414061.1 |
Coordinates | 3074222..3074488 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS14615 | 3069861..3070763 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M7V54_RS14620 | 3070832..3071584 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
M7V54_RS14625 | 3071611..3071748 | - | 138 | Protein_2886 | type II toxin-antitoxin system VapC family toxin | - |
M7V54_RS14630 | 3071828..3072103 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
M7V54_RS14635 | 3072100..3073722 | - | 1623 | WP_003906897.1 | class I SAM-dependent DNA methyltransferase | - |
M7V54_RS14640 | 3073809..3074225 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
M7V54_RS14645 | 3074222..3074488 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M7V54_RS14650 | 3074514..3074909 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
M7V54_RS14655 | 3074906..3075175 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M7V54_RS14660 | 3075185..3076279 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
M7V54_RS14665 | 3076276..3076695 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
M7V54_RS14670 | 3076694..3076768 | + | 75 | Protein_2895 | hypothetical protein | - |
M7V54_RS14675 | 3076769..3077248 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
M7V54_RS14680 | 3077319..3078119 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
M7V54_RS14685 | 3078275..3079012 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T264015 WP_003414059.1 NZ_CP110619:c3074225-3073809 [Mycobacterium tuberculosis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|