Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2933709..2934423 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag M7V54_RS13815 Protein ID WP_003413460.1
Coordinates 2933983..2934423 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag M7V54_RS13810 Protein ID WP_003413456.1
Coordinates 2933709..2933996 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS13775 2929131..2929376 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M7V54_RS13780 2929373..2929777 + 405 WP_003899389.1 type II toxin-antitoxin system VapC family toxin -
M7V54_RS13785 2929994..2930614 + 621 WP_003413441.1 DUF4178 domain-containing protein -
M7V54_RS13790 2930625..2931119 + 495 WP_003413444.1 DUF2617 family protein -
M7V54_RS13795 2931116..2931547 + 432 WP_003899390.1 DUF4247 domain-containing protein -
M7V54_RS13800 2931602..2932030 + 429 WP_178121172.1 DUF350 domain-containing protein -
M7V54_RS13805 2932027..2933598 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
M7V54_RS13810 2933709..2933996 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
M7V54_RS13815 2933983..2934423 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS13820 2934444..2935199 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
M7V54_RS13825 2935332..2935928 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
M7V54_RS13830 2935936..2936781 - 846 WP_003413466.1 acyl-CoA thioesterase II -
M7V54_RS13835 2936810..2937709 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
M7V54_RS13840 2937837..2938511 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T264013 WP_003413460.1 NZ_CP110619:2933983-2934423 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT264013 WP_003413456.1 NZ_CP110619:2933709-2933996 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References