Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2933709..2934423 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | M7V54_RS13815 | Protein ID | WP_003413460.1 |
Coordinates | 2933983..2934423 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | M7V54_RS13810 | Protein ID | WP_003413456.1 |
Coordinates | 2933709..2933996 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS13775 | 2929131..2929376 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
M7V54_RS13780 | 2929373..2929777 | + | 405 | WP_003899389.1 | type II toxin-antitoxin system VapC family toxin | - |
M7V54_RS13785 | 2929994..2930614 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
M7V54_RS13790 | 2930625..2931119 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
M7V54_RS13795 | 2931116..2931547 | + | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
M7V54_RS13800 | 2931602..2932030 | + | 429 | WP_178121172.1 | DUF350 domain-containing protein | - |
M7V54_RS13805 | 2932027..2933598 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
M7V54_RS13810 | 2933709..2933996 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
M7V54_RS13815 | 2933983..2934423 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS13820 | 2934444..2935199 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
M7V54_RS13825 | 2935332..2935928 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
M7V54_RS13830 | 2935936..2936781 | - | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
M7V54_RS13835 | 2936810..2937709 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
M7V54_RS13840 | 2937837..2938511 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T264013 WP_003413460.1 NZ_CP110619:2933983-2934423 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |