Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2872245..2872876 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ28 |
| Locus tag | M7V54_RS13540 | Protein ID | WP_003413174.1 |
| Coordinates | 2872499..2872876 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | M7V54_RS13535 | Protein ID | WP_003413167.1 |
| Coordinates | 2872245..2872502 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS13505 | 2868159..2868473 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| M7V54_RS13510 | 2868769..2869980 | + | 1212 | WP_009936235.1 | alpha/beta hydrolase family protein | - |
| M7V54_RS13515 | 2870107..2870766 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| M7V54_RS13520 | 2870763..2871425 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| M7V54_RS13525 | 2871422..2871700 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M7V54_RS13530 | 2871793..2872206 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| M7V54_RS13535 | 2872245..2872502 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| M7V54_RS13540 | 2872499..2872876 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M7V54_RS13545 | 2872892..2873266 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| M7V54_RS13550 | 2873366..2873761 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| M7V54_RS13555 | 2873758..2874003 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| M7V54_RS13560 | 2874414..2874833 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| M7V54_RS13565 | 2874845..2875654 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| M7V54_RS13570 | 2875651..2876904 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| M7V54_RS13575 | 2876897..2877409 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T264011 WP_003413174.1 NZ_CP110619:2872499-2872876 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |