Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2871793..2872502 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag M7V54_RS13530 Protein ID WP_003413164.1
Coordinates 2871793..2872206 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag M7V54_RS13535 Protein ID WP_003413167.1
Coordinates 2872245..2872502 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS13500 2866846..2868051 - 1206 WP_003413027.1 chorismate synthase -
M7V54_RS13505 2868159..2868473 + 315 WP_009937839.1 hypothetical protein -
M7V54_RS13510 2868769..2869980 + 1212 WP_009936235.1 alpha/beta hydrolase family protein -
M7V54_RS13515 2870107..2870766 + 660 WP_003900846.1 LppA family lipoprotein -
M7V54_RS13520 2870763..2871425 + 663 WP_003900848.1 LppA family lipoprotein -
M7V54_RS13525 2871422..2871700 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
M7V54_RS13530 2871793..2872206 + 414 WP_003413164.1 PIN domain nuclease Toxin
M7V54_RS13535 2872245..2872502 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
M7V54_RS13540 2872499..2872876 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
M7V54_RS13545 2872892..2873266 - 375 WP_003413177.1 hypothetical protein -
M7V54_RS13550 2873366..2873761 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
M7V54_RS13555 2873758..2874003 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
M7V54_RS13560 2874414..2874833 - 420 WP_003413190.1 A24 family peptidase -
M7V54_RS13565 2874845..2875654 - 810 WP_003413193.1 shikimate dehydrogenase -
M7V54_RS13570 2875651..2876904 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
M7V54_RS13575 2876897..2877409 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T264010 WP_003413164.1 NZ_CP110619:2871793-2872206 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT264010 WP_003413167.1 NZ_CP110619:2872245-2872502 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References