Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2857906..2858546 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag M7V54_RS13445 Protein ID WP_003412970.1
Coordinates 2857906..2858325 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag M7V54_RS13450 Protein ID WP_003412975.1
Coordinates 2858322..2858546 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS13415 2853491..2854213 - 723 WP_003412957.1 DUF1906 domain-containing protein -
M7V54_RS13420 2854730..2854957 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
M7V54_RS13425 2854954..2855355 + 402 WP_003412963.1 PIN domain-containing protein -
M7V54_RS13430 2855390..2856310 - 921 WP_003412965.1 restriction endonuclease -
M7V54_RS13435 2856651..2856896 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M7V54_RS13440 2856955..2857905 + 951 WP_003911916.1 ERCC4 domain-containing protein -
M7V54_RS13445 2857906..2858325 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS13450 2858322..2858546 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
M7V54_RS13455 2858577..2861420 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
M7V54_RS13460 2861492..2861893 - 402 WP_003412981.1 hypothetical protein -
M7V54_RS13465 2861893..2862363 - 471 WP_003899364.1 transcription antitermination factor NusB -
M7V54_RS13470 2862366..2862929 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T264009 WP_003412970.1 NZ_CP110619:c2858325-2857906 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT264009 WP_003412975.1 NZ_CP110619:c2858546-2858322 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References