Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2811722..2812374 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPX1 |
Locus tag | M7V54_RS13250 | Protein ID | WP_003412752.1 |
Coordinates | 2811949..2812374 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | M7V54_RS13245 | Protein ID | WP_003412749.1 |
Coordinates | 2811722..2811943 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS13230 | 2809962..2810168 | - | 207 | WP_003899347.1 | hypothetical protein | - |
M7V54_RS13235 | 2810304..2810927 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
M7V54_RS13240 | 2810917..2811669 | + | 753 | WP_003900859.1 | hypothetical protein | - |
M7V54_RS13245 | 2811722..2811943 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
M7V54_RS13250 | 2811949..2812374 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS13255 | 2812397..2813578 | - | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
M7V54_RS13260 | 2813575..2814621 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
M7V54_RS13265 | 2814632..2815735 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
M7V54_RS13270 | 2815994..2816815 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
M7V54_RS13275 | 2816812..2817369 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T264008 WP_003412752.1 NZ_CP110619:2811949-2812374 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TPX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |