Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2403766..2404295 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag M7V54_RS11315 Protein ID WP_003411124.1
Coordinates 2403766..2404083 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag M7V54_RS11320 Protein ID WP_003411127.1
Coordinates 2404080..2404295 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS11285 2398903..2399979 + 1077 WP_003411110.1 hypothetical protein -
M7V54_RS11290 2399976..2400257 + 282 WP_003411112.1 DUF5703 family protein -
M7V54_RS11295 2400293..2401366 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
M7V54_RS11300 2401371..2401901 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
M7V54_RS11305 2401949..2403295 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
M7V54_RS11315 2403766..2404083 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M7V54_RS11320 2404080..2404295 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
M7V54_RS11325 2404550..2405608 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
M7V54_RS11330 2405738..2406094 - 357 WP_003411130.1 hypothetical protein -
M7V54_RS11335 2406189..2406971 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
M7V54_RS11340 2407239..2407529 - 291 WP_003900476.1 YggT family protein -
M7V54_RS11345 2407691..2408347 - 657 WP_003411133.1 cell division protein SepF -
M7V54_RS11350 2408413..2409189 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T264007 WP_003411124.1 NZ_CP110619:c2404083-2403766 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT264007 WP_003411127.1 NZ_CP110619:c2404295-2404080 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References