Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2365659..2366354 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | M7V54_RS11105 | Protein ID | WP_003410811.1 |
Coordinates | 2365659..2366093 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | M7V54_RS11110 | Protein ID | WP_003410814.1 |
Coordinates | 2366100..2366354 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS11095 | 2361813..2364854 | + | 3042 | WP_003911743.1 | DEAD/DEAH box helicase | - |
M7V54_RS11100 | 2364847..2365680 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
M7V54_RS11105 | 2365659..2366093 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS11110 | 2366100..2366354 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
M7V54_RS11115 | 2366370..2366627 | - | 258 | WP_003410816.1 | hypothetical protein | - |
M7V54_RS11120 | 2367038..2368299 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
M7V54_RS11125 | 2368932..2369228 | + | 297 | WP_003410820.1 | PE family protein | - |
M7V54_RS11130 | 2369284..2370015 | + | 732 | WP_003900467.1 | PPE family protein | - |
M7V54_RS11135 | 2370556..2371302 | - | 747 | WP_003906749.1 | proteasome subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T264006 WP_003410811.1 NZ_CP110619:c2366093-2365659 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |