Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2259618..2260244 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | M7V54_RS10625 | Protein ID | WP_003410075.1 |
Coordinates | 2259846..2260244 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | M7V54_RS10620 | Protein ID | WP_003911750.1 |
Coordinates | 2259618..2259845 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS10610 | 2257657..2258001 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
M7V54_RS10615 | 2258190..2259359 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
M7V54_RS10620 | 2259618..2259845 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M7V54_RS10625 | 2259846..2260244 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
M7V54_RS10630 | 2260427..2260858 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
M7V54_RS10635 | 2260959..2261393 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
M7V54_RS10640 | 2261830..2262009 | - | 180 | Protein_2103 | hypothetical protein | - |
M7V54_RS10645 | 2262103..2262717 | + | 615 | WP_234715470.1 | IS110 family transposase | - |
M7V54_RS10650 | 2262671..2263261 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
M7V54_RS10655 | 2263389..2264645 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T264003 WP_003410075.1 NZ_CP110619:2259846-2260244 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|