263999

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2205253..2205797 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag M7V54_RS10335 Protein ID WP_003409896.1
Coordinates 2205253..2205549 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag M7V54_RS10340 Protein ID WP_003409899.1
Coordinates 2205546..2205797 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS10280 2200286..2200636 - 351 WP_003899096.1 hypothetical protein -
M7V54_RS10285 2200647..2201549 - 903 WP_003899097.1 hypothetical protein -
M7V54_RS10290 2201570..2201761 - 192 WP_003409876.1 hypothetical protein -
M7V54_RS10295 2201762..2202058 - 297 WP_003409877.1 hypothetical protein -
M7V54_RS10300 2202298..2202513 + 216 WP_003409878.1 antitoxin -
M7V54_RS10305 2202510..2202821 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
M7V54_RS10310 2202795..2203316 - 522 WP_003904745.1 hypothetical protein -
M7V54_RS10315 2203291..2203668 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
M7V54_RS10320 2203710..2204159 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
M7V54_RS10325 2204156..2204701 + 546 WP_003409891.1 SecB-like chaperone -
M7V54_RS10330 2204590..2205204 - 615 WP_003901296.1 hypothetical protein -
M7V54_RS10335 2205253..2205549 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M7V54_RS10340 2205546..2205797 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
M7V54_RS10345 2205784..2206278 + 495 WP_003899099.1 hypothetical protein -
M7V54_RS10350 2206438..2206845 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
M7V54_RS10355 2206849..2207121 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M7V54_RS10360 2207154..2208374 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
M7V54_RS10365 2209273..2210070 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T263999 WP_003409896.1 NZ_CP110619:c2205549-2205253 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT263999 WP_003409899.1 NZ_CP110619:c2205797-2205546 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References