Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2196216..2196919 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | M7V54_RS10245 | Protein ID | WP_003409778.1 |
Coordinates | 2196216..2196545 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | M7V54_RS10250 | Protein ID | WP_003409780.1 |
Coordinates | 2196542..2196919 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS10225 | 2192599..2193669 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
M7V54_RS10230 | 2193666..2194181 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
M7V54_RS10235 | 2194178..2195239 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
M7V54_RS10240 | 2195236..2196006 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
M7V54_RS10245 | 2196216..2196545 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M7V54_RS10250 | 2196542..2196919 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
M7V54_RS10255 | 2196916..2197506 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
M7V54_RS10260 | 2197561..2198925 | + | 1365 | WP_003903691.1 | HNH endonuclease signature motif containing protein | - |
M7V54_RS10265 | 2199080..2199532 | - | 453 | WP_003899095.1 | lipoprotein | - |
M7V54_RS10270 | 2199596..2199997 | + | 402 | WP_003409869.1 | hypothetical protein | - |
M7V54_RS10275 | 2199990..2200172 | - | 183 | WP_003409870.1 | hypothetical protein | - |
M7V54_RS10280 | 2200286..2200636 | - | 351 | WP_003899096.1 | hypothetical protein | - |
M7V54_RS10285 | 2200647..2201549 | - | 903 | WP_003899097.1 | hypothetical protein | - |
M7V54_RS10290 | 2201570..2201761 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T263997 WP_003409778.1 NZ_CP110619:c2196545-2196216 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT263997 WP_003409780.1 NZ_CP110619:c2196919-2196542 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|