Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1764983..1765596 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64880 |
| Locus tag | M7V54_RS08300 | Protein ID | WP_003407786.1 |
| Coordinates | 1765192..1765596 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
| Locus tag | M7V54_RS08295 | Protein ID | WP_009935474.1 |
| Coordinates | 1764983..1765186 (+) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS08265 | 1760388..1760768 | + | 381 | WP_003916859.1 | fumarate reductase subunit C | - |
| M7V54_RS08270 | 1760765..1761142 | + | 378 | WP_003407771.1 | fumarate reductase subunit FrdD | - |
| M7V54_RS08275 | 1761210..1761818 | + | 609 | WP_003407773.1 | TetR/AcrR family transcriptional regulator | - |
| M7V54_RS08280 | 1761996..1763150 | + | 1155 | Protein_1633 | MMPL family transporter | - |
| M7V54_RS08285 | 1763160..1763606 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
| M7V54_RS08290 | 1763641..1764930 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
| M7V54_RS08295 | 1764983..1765186 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M7V54_RS08300 | 1765192..1765596 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
| M7V54_RS08305 | 1765613..1767355 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
| M7V54_RS08310 | 1767348..1769645 | - | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T263994 WP_003407786.1 NZ_CP110619:1765192-1765596 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|