Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1686484..1687100 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | M7V54_RS07955 | Protein ID | WP_003407593.1 |
| Coordinates | 1686783..1687100 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | M7V54_RS07950 | Protein ID | WP_003900349.1 |
| Coordinates | 1686484..1686786 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS07940 | 1682370..1684217 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
| M7V54_RS07945 | 1684218..1686470 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| M7V54_RS07950 | 1686484..1686786 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| M7V54_RS07955 | 1686783..1687100 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| M7V54_RS07960 | 1687097..1688101 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| M7V54_RS07965 | 1688154..1689443 | + | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
| M7V54_RS07970 | 1689516..1690241 | - | 726 | WP_023641476.1 | class I SAM-dependent methyltransferase | - |
| M7V54_RS07975 | 1690347..1690559 | - | 213 | WP_003898900.1 | dodecin family protein | - |
| M7V54_RS07980 | 1690620..1691018 | + | 399 | WP_003900351.1 | hypothetical protein | - |
| M7V54_RS07985 | 1691063..1692091 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T263993 WP_003407593.1 NZ_CP110619:1686783-1687100 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|