Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1574118..1574773 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA6 |
Locus tag | M7V54_RS07455 | Protein ID | WP_003898861.1 |
Coordinates | 1574118..1574519 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TIK2 |
Locus tag | M7V54_RS07460 | Protein ID | WP_003407272.1 |
Coordinates | 1574516..1574773 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS07440 | 1569590..1570975 | - | 1386 | WP_003911514.1 | cytochrome P450 | - |
M7V54_RS07445 | 1571053..1572087 | + | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
M7V54_RS07450 | 1572133..1573863 | - | 1731 | WP_010886114.1 | PE family protein | - |
M7V54_RS07455 | 1574118..1574519 | - | 402 | WP_003898861.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS07460 | 1574516..1574773 | - | 258 | WP_003407272.1 | CopG family transcriptional regulator | Antitoxin |
M7V54_RS07465 | 1574856..1575815 | - | 960 | WP_003407276.1 | alpha/beta hydrolase | - |
M7V54_RS07470 | 1575840..1576802 | - | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
M7V54_RS07475 | 1576801..1577538 | + | 738 | WP_031647000.1 | lysoplasmalogenase | - |
M7V54_RS07480 | 1577619..1579586 | + | 1968 | WP_003407285.1 | primosomal protein N' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14952.43 Da Isoelectric Point: 11.4656
>T263992 WP_003898861.1 NZ_CP110619:c1574519-1574118 [Mycobacterium tuberculosis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A045ISB0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TIK2 |