Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1384284..1384972 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0THR7 |
Locus tag | M7V54_RS06630 | Protein ID | WP_003406304.1 |
Coordinates | 1384541..1384972 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0THR6 |
Locus tag | M7V54_RS06625 | Protein ID | WP_003406302.1 |
Coordinates | 1384284..1384544 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS06605 | 1379861..1380685 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
M7V54_RS06610 | 1380690..1381871 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
M7V54_RS06615 | 1381948..1383048 | - | 1101 | WP_003916789.1 | magnesium/cobalt transporter CorA | - |
M7V54_RS06620 | 1383219..1384208 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
M7V54_RS06625 | 1384284..1384544 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
M7V54_RS06630 | 1384541..1384972 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS06635 | 1384995..1386683 | - | 1689 | WP_003910308.1 | PE family protein | - |
M7V54_RS06640 | 1386863..1387723 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
M7V54_RS06645 | 1387804..1388634 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
M7V54_RS06650 | 1388691..1388984 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
M7V54_RS06655 | 1388981..1389250 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T263989 WP_003406304.1 NZ_CP110619:1384541-1384972 [Mycobacterium tuberculosis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|